GPR123 (ADGRA1) Rabbit Polyclonal Antibody

SKU TA342756

Rabbit Polyclonal Anti-GPR123 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR123 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR123. Synthetic peptide located within the following region: YHIPSSLDGSPRSSRTDSPPSSLDGPAGTHTLACCTQGDPFPMVTQPEGS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: adhesion G protein-coupled receptor A1
• Database Link:
  NP_001077378
  Q86SQ6
• Background: GPR123 is a orphan receptor.
• Synonyms: GPR123
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 85%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane