OR1C1 Rabbit Polyclonal Antibody

SKU
TA342694
Rabbit Polyclonal Anti-OR1C1 Antibody
$585.00
5 Days*
Specifications
Product Data
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-OR1C1 antibody: synthetic peptide directed towards the C terminal of human OR1C1. Synthetic peptide located within the following region: AVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVSTCSCHLSVVVL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 35 kDa
Gene Name olfactory receptor family 1 subfamily C member 1
Database Link
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Synonyms HSTPCR27; OR1-42; OR1.5.10; ORL211; TPCR27
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%
Reference Data
Protein Pathways Olfactory transduction
Write Your Own Review
You're reviewing:OR1C1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.