SLC6A11 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SLC6A11 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC6A11. Synthetic peptide located within the following region: EGTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAIT |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 70 kDa |
Gene Name | solute carrier family 6 member 11 |
Database Link | |
Background | Gamma-aminobutyric acid (GABA) is a major inhibitory neurotransmitter. GABAergic neurotransmission is terminated by the uptake of GABA into the presynaptic terminal and the surrounding astroglial cells by sodium-dependent transporters, such as SLC6A11. |
Synonyms | GAT-3; GAT3; GAT4 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 92%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 85%; Bovine: 85%; Mouse |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.