SLC6A11 Rabbit Polyclonal Antibody

CAT#: TA342664

Rabbit Polyclonal Anti-SLC6A11 Antibody

Product Images

Host: Rabbit; Target Name: SLC6A11; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC6A11 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC6A11. Synthetic peptide located within the following region: EGTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAIT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: solute carrier family 6 member 11
• Database Link:
  NP_055044
  Entrez Gene 6538 Human
  UniProt ID P48066
• Background: Gamma-aminobutyric acid (GABA) is a major inhibitory neurotransmitter. GABAergic neurotransmission is terminated by the uptake of GABA into the presynaptic terminal and the surrounding astroglial cells by sodium-dependent transporters, such as SLC6A11.
• Synonyms: GAT-3; GAT3; GAT4
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 92%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 85%; Bovine: 85%; Mouse

Reference Data

• Protein Families: Druggable Genome, Transmembrane