USP47 Rabbit Polyclonal Antibody

SKU TA342576

Rabbit Polyclonal Anti-USP47 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-USP47 antibody: synthetic peptide directed towards the middle region of human USP47. Synthetic peptide located within the following region: SITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 147 kDa
• Gene Name: ubiquitin specific peptidase 47
• Database Link:
  NP_060414
  Q96K76
• Background: USP47 is a putative ubiquitin-specific-processing protease that regulates cell growth and survival. USP47 probably regulates CDC25A expression at a transcriptional level. USP47 may be catalytically inactive although it seems to have kept all necessary active site residues.
• Synonyms: TRFP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data