USP47 Rabbit Polyclonal Antibody

SKU
TA342576
Rabbit Polyclonal Anti-USP47 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-USP47 antibody: synthetic peptide directed towards the middle region of human USP47. Synthetic peptide located within the following region: SITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 147 kDa
Gene Name ubiquitin specific peptidase 47
Database Link
Background USP47 is a putative ubiquitin-specific-processing protease that regulates cell growth and survival. USP47 probably regulates CDC25A expression at a transcriptional level. USP47 may be catalytically inactive although it seems to have kept all necessary active site residues.
Synonyms TRFP
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Write Your Own Review
You're reviewing:USP47 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.