USP35 Rabbit Polyclonal Antibody

SKU TA342574

Rabbit Polyclonal Anti-USP35 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-USP35 antibody: synthetic peptide directed towards the C terminal of human USP35. Synthetic peptide located within the following region: MEAISKDNILYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 113 kDa
• Gene Name: ubiquitin specific peptidase 35
• Database Link:
  NP_065849
  Q9P2H5
• Background: The function of USP35 remians unknown.
• Synonyms: KIAA1372; USP34
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 83%; Horse: 82%; Yeast: 82%

Reference Data

• Protein Families: Druggable Genome, Protease