ZNF483 Rabbit Polyclonal Antibody

SKU
TA342489
Rabbit Polyclonal Anti-ZNF483 Antibody
$585.00
2 Weeks*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF483 antibody: synthetic peptide directed towards the N terminal of human ZNF483. Synthetic peptide located within the following region: EAILRGNAADAESFRQRFRWFCYSEVAGPRKALSQLWELCNQWLRPDIHT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 85 kDa
Gene Name zinc finger protein 483
Database Link
Background May be involved in transcriptional regulation.
Synonyms ZKSCAN16; ZSCAN48
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Horse: 93%; Rat: 85%; Bovine: 85%; Guinea pig: 79%; Mouse: 77%; Rabbit: 77%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZNF483 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.