MTA3 Rabbit Polyclonal Antibody

CAT#: TA342466

Rabbit Polyclonal Anti-MTA3 Antibody

Product Images

WB Suggested Anti-MTA3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MTA3 antibody: synthetic peptide directed towards the C terminal of human MTA3. Synthetic peptide located within the following region: TTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: metastasis associated 1 family member 3
• Database Link:
  NP_065795
  Entrez Gene 57504 Human
  UniProt ID Q9BTC8
• Background: MTA3 plays a role in maintenance of the normal epithelial architecture through the repression of SNAI1 transcription in a histone deacetylase-dependent manner, and thus the regulation of E-cadherin levels.
• Synonyms: KIAA1266
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors