ZNF37A Rabbit Polyclonal Antibody

SKU TA342396

Rabbit Polyclonal Anti-ZNF37A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF37A antibody: synthetic peptide directed towards the middle region of human ZNF37A. Synthetic peptide located within the following region: QQRTHTGEKPYECHECGKTFTQKSAHTRHQRTHTGGKPYECHECGKTFYK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 65 kDa
• Gene Name: zinc finger protein 37A
• Database Link:
  NP_001007095
  P17032
• Background: May be involved in transcriptional regulation.
• Synonyms: KOX21; ZNF37
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 92%; Pig: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors