C7orf42 (TMEM248) Rabbit Polyclonal Antibody

SKU TA342351

Rabbit Polyclonal Anti-C7orf42 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C7orf42 antibody: synthetic peptide directed towards the N terminal of human C7orf42. Synthetic peptide located within the following region: FSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: transmembrane protein 248
• Database Link:
  NP_060464
  Q9NWD8
• Background: The exact function of C7orf42 remains unknown.
• Synonyms: C7orf42
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 85%

Reference Data

• Protein Families: Transmembrane