SUSD4 Rabbit Polyclonal Antibody

SKU
TA342349
Rabbit Polyclonal Anti-SUSD4 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SUSD4 antibody: synthetic peptide directed towards the N terminal of human SUSD4. Synthetic peptide located within the following region: MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name sushi domain containing 4
Database Link
Background SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown.
Synonyms PRO222
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Yeast: 92%; Rabbit: 85%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SUSD4 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.