Taf1b Rabbit Polyclonal Antibody

SKU TA342344

Rabbit Polyclonal Anti-Taf1b Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Taf1b antibody: synthetic peptide directed towards the middle region of mouse Taf1b. Synthetic peptide located within the following region: KYDVQAMAVIVVVLKLLFLLDDKLEWSYSDLAEAYNEQHREDTPQFDFRK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 68 kDa
• Gene Name: TATA-box binding protein associated factor, RNA polymerase I, B
• Database Link:
  NP_065639
  P97358
• Background: Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits.
• Synonyms: MGC:9349; RAF1B; RAFI63; SL1; TAFI63
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 79%

Reference Data