Taf1b Rabbit Polyclonal Antibody

SKU TA342343

Rabbit Polyclonal Anti-TAF1B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAF1B antibody: synthetic peptide directed towards the C terminal of mouse TAF1B. Synthetic peptide located within the following region: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: TATA-box binding protein associated factor, RNA polymerase I, B
• Database Link:
  NP_065639
  P97358
• Background: TAF1b belongs to the family of TATA box binding protein (Tbp)-associated factors. Promoter selectivity for all three classes of eukaryotic RNA polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs).
• Synonyms: MGC:9349; RAF1B; RAFI63; SL1; TAFI63
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 92%; Pig: 82%; Guinea pig: 82%

Reference Data