TBX21 Rabbit Polyclonal Antibody

SKU TA342330

Rabbit Polyclonal Anti-TBX21 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the C terminal of mouse TBX21. Synthetic peptide located within the following region: MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKRRRISPYPSSG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: T-box 21
• Database Link:
  NP_037483
  Q9UL17
• Background: Transcription factor that controls the expression of the TH1 cytokine, interferon-gamma. Initiates TH1 lineage development from naive TH precursor cells both by activating TH1 genetic programs and by repressing the opposing TH2 programs.
• Synonyms: T-bet; T-PET; TBET; TBLYM
• Note: Immunogen Sequence Homology: Pig: 93%; Rat: 93%; Human: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Sheep: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors