ATP6V0A1 Rabbit Polyclonal Antibody

SKU TA342323

Rabbit Polyclonal Anti-Atp6v0a1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB, IF
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Atp6v0a1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 96 kDa
• Gene Name: ATPase H+ transporting V0 subunit a1
• Database Link:
  NP_005168
  Q93050
• Background: Required for assembly and activity of the vacuolar ATPase. Potential role in differential targeting and regulation of the enzyme for a specific organelle.
• Synonyms: a1; ATP6N1; ATP6N1A; Stv1; Vph1; VPP1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Human: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection