ATP6V0A1 Rabbit Polyclonal Antibody
USD 665.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB, IF |
Reactivities | Mouse, Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Atp6v0a1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 96 kDa |
Gene Name | ATPase H+ transporting V0 subunit a1 |
Database Link | |
Background | Required for assembly and activity of the vacuolar ATPase. Potential role in differential targeting and regulation of the enzyme for a specific organelle. |
Synonyms | a1; ATP6N1; ATP6N1A; Stv1; Vph1; VPP1 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Human: 86% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review