OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ATP6V0A1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342323
Rabbit Polyclonal Anti-Atp6v0a1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY417468 Transient overexpression lysate of ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 3 (as WB positive control) 100 ug
$665.00
TP323769 Recombinant protein of human ATPase, H+ transporting, lysosomal V0 subunit a1 (ATP6V0A1), transcript variant 3, 20 µg
20 ug
$737.00

View other "ATP6V0A1 or NM_005177" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB, IF
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Atp6v0a1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 96 kDa
Gene Name ATPase H+ transporting V0 subunit a1
Database Link
Background Required for assembly and activity of the vacuolar ATPase. Potential role in differential targeting and regulation of the enzyme for a specific organelle.
Synonyms a1; ATP6N1; ATP6N1A; Stv1; Vph1; VPP1
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Human: 86%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins, Nervous system Diseases
Protein Families Transmembrane
Protein Pathways Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products