Eomes Rabbit Polyclonal Antibody

CAT#: TA342257

Rabbit Polyclonal Anti-Eomes Antibody


 Product Datasheet for 'TA342257'

USD 360.00


Availability*
In Stock

Size
    • 100 ul


Product images

Specifications

Product Data
Clone Name Polyclonal
Applications IHC, WB
Recommend Dilution IHC, WB
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-Eomes antibody: synthetic peptide directed towards the C terminal of human Eomes. Synthetic peptide located within the following region: SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 75 kDa
Gene Name Mus musculus eomesodermin (Eomes), transcript variant 1
Background Eomes functions as a transcriptional activator playing a crucial role during development. Eomes functions in trophoblast differentiation and later in gastrulation, regulating both mesoderm delamination and endoderm specification.Eomes plays a role in brain development being required for the specification and the proliferation of the intermediate progenitor cells and their progeny in the cerebral cortex. Eomes also involved in the differentiation of CD8+ T-cells during immune response regulating the expression of lytic effector genes.
Synonyms C77258; TBR-2; Tbr2
Note Immunogen Sequence Homology: Mouse: 100%; Rat: 87%; Dog: 80%; Pig: 80%; Bovine: 80%; Guinea pig: 80%
Reference Data
Other products for "Eomes"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones