OMD Rabbit Polyclonal Antibody

SKU TA342231

Rabbit polyclonal Anti-OMD Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OMD antibody: synthetic peptide directed towards the middle region of human OMD. Synthetic peptide located within the following region: LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: osteomodulin
• Database Link:
  NP_005005
  Q99983
• Background: OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts viaThe alpha(V)beta(3)-integrin.
• Synonyms: OSAD; SLRR2C
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 93%; Rabbit: 92%; Dog: 86%; Bovine: 86%; Horse: 85%; Zebrafish: 79%

Reference Data

• Protein Families: Secreted Protein