PRKRIR (THAP12) Rabbit Polyclonal Antibody

CAT#: TA342224

Rabbit polyclonal Anti-PRKRIR Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor) (PRKRIR)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor) (PRKRIR), 20 µg
    • 20 ug

USD 867.00

Other products for "PRKRIR"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PRKRIR antibody: synthetic peptide directed towards the N terminal of human PRKRIR. Synthetic peptide located within the following region: VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 88 kDa
Gene Name THAP domain containing 12
Background Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). May blockThe PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth.
Synonyms DAP4; P52rIPK; PRKRIR; THAP0
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.