SH3BP2 Rabbit Polyclonal Antibody

SKU TA342205

Rabbit polyclonal Anti-SH3BP2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SH3BP2 antibody: synthetic peptide directed towards the middle region of human SH3BP2. Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 62 kDa
• Gene Name: SH3 domain binding protein 2
• Database Link:
  NP_003014
  P78314
• Background: The protein encoded byThis gene has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain.The protein binds toThe SH3 domains of several proteins includingThe ABL1 and SYK protein tyrosine kinases , and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations inThis gene result in cherubism. Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2009]
• Synonyms: 3BP-2; 3BP2; CRBM; CRPM; RES4-23
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Natural killer cell mediated cytotoxicity