Kallikrein 10 (KLK10) Rabbit Polyclonal Antibody

SKU TA342159

Rabbit polyclonal Anti-KLK10 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLK10 antibody: synthetic peptide directed towards the N terminal of human KLK10. Synthetic peptide located within the following region: LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: kallikrein related peptidase 10
• Database Link:
  NP_002767
  O43240
• Background: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.This gene is one ofThe fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing ofThis gene results in multiple transcript variants encodingThe same protein. [provided by RefSeq, Jul 2008]
• Synonyms: NES1; PRSSL1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein