ZIK1 Rabbit Polyclonal Antibody

SKU
TA342130
Rabbit Polyclonal Anti-ZIK1 Antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZIK1 antibody: synthetic peptide directed towards the N terminal of human ZIK1. Synthetic peptide located within the following region: LYLEVMLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQ
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 55 kDa
Gene Name zinc finger protein interacting with K protein 1
Database Link
Background ZIK1 may be a transcriptional repressor.
Synonyms ZNF762
Note Immunogen Sequence Homology: Human: 100%; Pig: 83%; Bovine: 83%; Rat: 77%; Horse: 75%
Reference Data
Write Your Own Review
You're reviewing:ZIK1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.