Germany
Japan
United Kingdom
China
ZIK1 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein interacting with K protein 1 homolog (mouse) (ZIK1)
USD 665.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "ZIK1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ZIK1 antibody: synthetic peptide directed towards the N terminal of human ZIK1. Synthetic peptide located within the following region: LYLEVMLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQ |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 55 kDa |
| Gene Name | zinc finger protein interacting with K protein 1 |
| Database Link | |
| Background | ZIK1 may be a transcriptional repressor. |
| Synonyms | ZNF762 |
| Note | Immunogen Sequence Homology: Human: 100%; Pig: 83%; Bovine: 83%; Rat: 77%; Horse: 75% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.