GALNTL2 (GALNT15) Rabbit Polyclonal Antibody

SKU TA342081

Rabbit Polyclonal Anti-GALNT15 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GALNT15 antibody is: synthetic peptide directed towards the N-terminal region of Human GALNT15. Synthetic peptide located within the following region: LMLGCVLMMVAMLHPPHHTLHQTVTAQASKHSPEARYRLDFGESQDWVLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 67 kDa
• Gene Name: polypeptide N-acetylgalactosaminyltransferase 15
• Database Link:
  NP_473451
  Q8N3T1
• Background: The function ofThis protein remains unknown.
• Synonyms: GALNACT15; GALNT7; GALNT13; GALNTL2; PIH5; pp-GalNAc-T15
• Note: Immunogen Sequence Homology: Human: 93%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, O-Glycan biosynthesis