BPNT2 Rabbit Polyclonal Antibody

SKU
TA342036
Rabbit Polyclonal Anti-IMPAD1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-IMPAD1 antibody: synthetic peptide directed towards the middle region of human IMPAD1. Synthetic peptide located within the following region: TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTII
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 39 kDa
Gene Name inositol monophosphatase domain containing 1
Database Link
Background This gene encodes a member ofThe inositol monophosphatase family.The encoded protein is localized toThe Golgi apparatus and catalyzesThe hydrolysis of phosphoadenosine phosphate (PAP) to adenosine monophosphate (AMP). Mutations inThis gene are a cause of GRAPP type chondrodysplasia with joint dislocations, and a pseudogene ofThis gene is located onThe long arm of chromosome 1. [provided by RefSeq, Dec 2011]
Synonyms GPAPP; IMP-3; IMP 3; IMPA3
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:BPNT2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.