LAX1 Rabbit Polyclonal Antibody

CAT#: TA342035

Rabbit Polyclonal Anti-LAX1 Antibody

Product Images

WB Suggested Anti-LAX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LAX1 antibody: synthetic peptide directed towards the middle region of human LAX1. Synthetic peptide located within the following region: LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: lymphocyte transmembrane adaptor 1
• Database Link:
  NP_060243
  Entrez Gene 54900 Human
  UniProt ID Q8IWV1
• Background: LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.
• Synonyms: LAX
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 79%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane