LAX1 Rabbit Polyclonal Antibody

SKU TA342035

Rabbit Polyclonal Anti-LAX1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LAX1 antibody: synthetic peptide directed towards the middle region of human LAX1. Synthetic peptide located within the following region: LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: lymphocyte transmembrane adaptor 1
• Database Link:
  NP_060243
  Q8IWV1
• Background: LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.
• Synonyms: LAX
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 79%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane