FA20A (FAM20A) Rabbit Polyclonal Antibody

CAT#: TA342031

Rabbit Polyclonal Anti-FAM20A Antibody

Product Images

WB Suggested Anti-FAM20A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM20A antibody: synthetic peptide directed towards the N terminal of human FAM20A. Synthetic peptide located within the following region: SKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: family with sequence similarity 20 member A
• Database Link:
  NP_060035
  Entrez Gene 54757 Human
  UniProt ID Q96MK3
• Background: This locus encodes a protein that is likely secreted and may function in hematopoiesis. A mutation atThis locus has been associated with amelogenesis imperfecta and gingival hyperplasia syndrome. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Aug 2011]
• Synonyms: AI1G; AIGFS; FP2747
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Secreted Protein, Transmembrane