CEND1 Rabbit Polyclonal Antibody

CAT#: TA342017

Rabbit Polyclonal Anti-CEND1 Antibody

Product Images

WB Suggested Anti-CEND1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CEND1 antibody: synthetic peptide directed towards the N terminal of human CEND1. Synthetic peptide located within the following region: MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: cell cycle exit and neuronal differentiation 1
• Database Link:
  NP_057648
  Entrez Gene 51286 Human
  UniProt ID Q8N111
• Background: The protein encoded byThis gene is a neuron-specific protein.The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported forThis gene. [provided by RefSeq, Jul 2008]
• Synonyms: BM88
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane