KLRF1 Rabbit Polyclonal Antibody

SKU TA342016

Rabbit Polyclonal Anti-KLRF1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLRF1 antibody: synthetic peptide directed towards the middle region of human KLRF1. Synthetic peptide located within the following region: QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 26 kDa
• Gene Name: killer cell lectin like receptor F1
• Database Link:
  NP_057607
  Q9NZS2
• Background: KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulatesTheir cytoxicity and cytokine release (Kuttruff et al., 2009 [PubMed 18922855]). [supplied by OMIM, Oct 2009]. Transcript Variant:This variant (KLRF1-s3) lacks three alternate coding exons that result in a frameshift inThe 3' coding region, compared to variant 1.The encoded isoform (KLRF1-s3) has a distinct C-terminus and is significantly shorter than isoform 1. ##Evidence-Data-START## Transcript exon combination :: AF267245.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025084, ERS025085 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
• Synonyms: CLEC5C; NKp80
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane