IER3IP1 Rabbit Polyclonal Antibody

SKU TA341996

Rabbit Polyclonal Anti-Ier3ip1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ier3ip1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 9 kDa
• Gene Name: immediate early response 3 interacting protein 1
• Database Link:
  NP_057181
  Q9Y5U9
• Background: May be implicated inThe regulation of apoptosis (By similarity). May be involved in protein transport between endoplasmic reticulum and Golgi apparatus.
• Synonyms: HSPC039; MEDS; PRO2309
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane