DHRS7B Rabbit Polyclonal Antibody

SKU TA341981

Rabbit Polyclonal Anti-DHRS7B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DHRS7B antibody: synthetic peptide directed towards the middle region of human DHRS7B. Synthetic peptide located within the following region: QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: dehydrogenase/reductase 7B
• Database Link:
  NP_056325
  Q6IAN0
• Background: This gene is located withinThe Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function. [provided by RefSeq, Jul 2008]
• Synonyms: CGI-93; SDR32C1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane