KIAA0247 (SUSD6) Rabbit Polyclonal Antibody

SKU TA341952

Rabbit Polyclonal Anti-KIAA0247 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIAA0247 antibody: synthetic peptide directed towards the N terminal of human KIAA0247. Synthetic peptide located within the following region: YLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLSI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: sushi domain containing 6
• Database Link:
  NP_055549
  Q92537
• Background: KIAA0247 is a single-pass type I membrane protein. It contains 1 Sushi (CCP/SCR) domain.The function ofThe KIAA0247 protein remains unknown.
• Synonyms: DRAGO; KIAA0247
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane