LAPTM4A Rabbit Polyclonal Antibody

SKU TA341950

Rabbit Polyclonal Anti-LAPTM4A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LAPTM4A antibody: synthetic peptide directed towards the middle region of human LAPTM4A. Synthetic peptide located within the following region: VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: lysosomal protein transmembrane 4 alpha
• Database Link:
  NP_055528
  Q15012
• Background: This gene encodes a protein that has four predicted transmembrane domains.The function ofThis gene has not yet been determined; however, studies inThe mouse homolog suggest a role inThe transport of small molecules across endosomal and lysosomal membranes. [provided by RefSeq, Jul 2008]
• Synonyms: HUMORF13; LAPTM4; MBNT; Mtrp
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Lysosome