ERVWE1 (ERVW-1) Rabbit Polyclonal Antibody

SKU TA341944

Rabbit Polyclonal Anti-ERVWE1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERVWE1 antibody: synthetic peptide directed towards the N terminal of human ERVWE1. Synthetic peptide located within the following region: TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 24 kDa
• Gene Name: endogenous retrovirus group W member 1
• Database Link:
  NP_055405
  Q9UQF0
• Background: Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction.This gene is part of an HERV provirus on chromosome 7 that has inactivating mutations inThe gag and pol genes.This gene isThe envelope glycoprotein gene which appears to have been selectively preserved.The gene's protein product is expressed inThe placental syncytiotrophoblast and is involved in fusion ofThe cytotrophoblast cells to formThe syncytial layer ofThe placenta.The protein hasThe characteristics of a typical retroviral envelope protein, including a furin cleavage site that separatesThe surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encodingThe same protein have been found forThis gene. [provided by RefSeq, Mar 2010]
• Synonyms: ENV; ENVW; ERVWE1; HERV-7q; HERV-W-ENV; HERV7Q; HERVW; HERVWENV
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 91%

Reference Data

• Protein Families: Transmembrane