Torsin B (TOR1B) Rabbit Polyclonal Antibody

CAT#: TA341941

Rabbit Polyclonal Anti-TOR1B Antibody

Product Images

WB Suggested Anti-TOR1B Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TOR1B antibody: synthetic peptide directed towards the C terminal of human TOR1B. Synthetic peptide located within the following region: VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: torsin family 1 member B
• Database Link:
  NP_055321
  Entrez Gene 27348 Human
  UniProt ID O14657
• Background: TOR1B may serve as a molecular chaperone assisting inThe proper folding of secreted and/or membrane proteins.
• Synonyms: DQ1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Rabbit: 85%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane