ALG6 Rabbit Polyclonal Antibody

SKU TA341916

Rabbit Polyclonal Anti-ALG6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALG6 antibody: synthetic peptide directed towards the N terminal of human ALG6. Synthetic peptide located within the following region: PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: ALG6, alpha-1,3-glucosyltransferase
• Database Link:
  NP_037471
  Q9Y672
• Background: This gene encodes a member ofThe ALG6/ALG8 glucosyltransferase family.The encoded protein catalyzesThe addition ofThe first glucose residue toThe growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations inThis gene are associated with congenital disorders of glycosylation type Ic. [provided by RefSeq, Jul 2008]
• Synonyms: CDG1C
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Dog: 92%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Metabolic pathways, N-Glycan biosynthesis