TSPAN12 Rabbit Polyclonal Antibody

SKU TA341907

Rabbit Polyclonal Anti-TSPAN12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TSPAN12 antibody: synthetic peptide directed towards the middle region of human TSPAN12. Synthetic peptide located within the following region: EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: tetraspanin 12
• Database Link:
  NP_036470
  O95859
• Background: The protein encoded byThis gene is a member ofThe transmembrane 4 superfamily, also known asThe tetraspanin family. Most ofThese members are cell-surface proteins that are characterized byThe presence of four hydrophobic domains.The proteins mediate signal transduction events that play a role inThe regulation of cell development, activation, growth and motility. [provided by RefSeq, Jul 2008]
• Synonyms: EVR5; NET-2; NET2; TM4SF12
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Transmembrane