DNAJB9 Rabbit Polyclonal Antibody

SKU TA341906

Rabbit Polyclonal Anti-DNAJB9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DNAJB9 antibody: synthetic peptide directed towards the N terminal of human DNAJB9. Synthetic peptide located within the following region: MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: DnaJ heat shock protein family (Hsp40) member B9
• Database Link:
  NP_036460
  Q9UBS3
• Background: This gene is a member ofThe J protein family. J proteins function in many cellular processes by regulatingThe ATPase activity of 70 kDa heat shock proteins.This gene is a member ofThe type 2 subgroup of DnaJ proteins.The encoded protein is localized toThe endoplasmic reticulum.This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis. [provided by RefSeq, Dec 2010]
• Synonyms: ERdj4; MDG-1; MDG1; MST049; MSTP049
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 93%; Yeast: 83%; Goat: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane