B3GAT3 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-B3GAT3 antibody: synthetic peptide directed towards the N terminal of human B3GAT3. Synthetic peptide located within the following region: PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 37 kDa |
Gene Name | beta-1,3-glucuronyltransferase 3 |
Database Link | |
Background | The protein encoded byThis gene is a member ofThe glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars andTheir anomeric linkages.This gene product catalyzesThe formation ofThe glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction inThe final step ofThe biosynthesis ofThe linkage region of proteoglycans. A pseudogene ofThis gene has been identified on chromosome 3. [provided by RefSeq, Dec 2013] |
Synonyms | GLCATI; glcUAT-I; JDSCD |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Goat: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Chondroitin sulfate biosynthesis, Heparan sulfate biosynthesis, Metabolic pathways |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.