B3GAT3 Rabbit Polyclonal Antibody

SKU TA341900

Rabbit Polyclonal Anti-B3GAT3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-B3GAT3 antibody: synthetic peptide directed towards the N terminal of human B3GAT3. Synthetic peptide located within the following region: PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: beta-1,3-glucuronyltransferase 3
• Database Link:
  NP_036332
  O94766
• Background: The protein encoded byThis gene is a member ofThe glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars andTheir anomeric linkages.This gene product catalyzesThe formation ofThe glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction inThe final step ofThe biosynthesis ofThe linkage region of proteoglycans. A pseudogene ofThis gene has been identified on chromosome 3. [provided by RefSeq, Dec 2013]
• Synonyms: GLCATI; glcUAT-I; JDSCD
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Goat: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Chondroitin sulfate biosynthesis, Heparan sulfate biosynthesis, Metabolic pathways