BACE2 Rabbit Polyclonal Antibody

CAT#: TA341893

Rabbit Polyclonal Anti-BACE2 Antibody

 Product Datasheet for 'TA341893'

Need it in bulk or conjugated?
Get a free quote

USD 360.00

5 Days

    • 50 ug

Product images


Product Data
Clone Name Polyclonal
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the middle region of human BACE2. Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
Isotype IgG
Formulation Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1mg/ml
Predicted Protein Size 37kDa
Gene Name beta-site APP-cleaving enzyme 2
Background This gene encodes an integral membrane glycoprotein that functions as an aspartic protease.The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step inThe etiology of Alzheimer's disease and Down syndrome.The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013].
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 92%; Rabbit: 85%
Reference Data
Protein Families Transmembrane, Protease, Druggable Genome
Protein Pathways Alzheimer's disease
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.