TMED3 Rabbit Polyclonal Antibody

SKU TA341889

Rabbit Polyclonal Anti-TMED3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMED3 antibody: synthetic peptide directed towards the C terminal of human TMED3. Synthetic peptide located within the following region: DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: transmembrane p24 trafficking protein 3
• Database Link:
  NP_031390
  Q9Y3Q3
• Background: The function remains known.
• Synonyms: C15orf22; P24B; p26
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Dog: 79%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane