SEC63 Rabbit Polyclonal Antibody

SKU
TA341887
Rabbit Polyclonal Anti-SEC63 Antibody
$585.00
2 Weeks*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SEC63 antibody: synthetic peptide directed towards the N terminal of human SEC63. Synthetic peptide located within the following region: WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 88 kDa
Gene Name SEC63 homolog, protein translocation regulator
Database Link
Background The Sec61 complex isThe central component ofThe protein translocation apparatus ofThe endoplasmic reticulum (ER) membrane.The protein encoded byThis gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation intoThe ER.The Sec61-Sec62-Sec63 complex might also performThe backward transport of ER proteins that are subject toThe ubiquitin-proteasome-dependent degradation pathway.The encoded protein is an integral membrane protein located inThe rough ER. [provided by RefSeq, Jul 2008]
Synonyms DNAJC23; ERdj2; PRO2507; SEC63L
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 77%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SEC63 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.