KDELR3 Rabbit Polyclonal Antibody

SKU
TA341866
Rabbit Polyclonal Anti-KDELR3 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KDELR3 antibody: synthetic peptide directed towards the middle region of human KDELR3. Synthetic peptide located within the following region: AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 25 kDa
Gene Name KDEL endoplasmic reticulum protein retention receptor 3
Database Link
Background This gene encodes a member ofThe KDEL endoplasmic reticulum protein retention receptor family. Retention of resident soluble proteins inThe lumen ofThe endoplasmic reticulum (ER) is achieved in both yeast and animal cells byTheir continual retrieval fromThe cis-Golgi, or a pre-Golgi compartment. Sorting ofThese proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae.This process is mediated by a receptor that recognizes, and bindsThe tetrapeptide-containing protein, and returns it toThe ER. In yeast,The sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs ofThe ERD2 gene, constitutingThe KDEL receptor gene family, have been described. KDELR3 wasThe third member ofThe family to be identified. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Synonyms ERD2L3
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 92%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Vibrio cholerae infection
Write Your Own Review
You're reviewing:KDELR3 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.