KDELR3 Rabbit Polyclonal Antibody

CAT#: TA341866

Rabbit Polyclonal Anti-KDELR3 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3 (KDELR3), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "KDELR3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KDELR3 antibody: synthetic peptide directed towards the middle region of human KDELR3. Synthetic peptide located within the following region: AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name KDEL endoplasmic reticulum protein retention receptor 3
Background This gene encodes a member ofThe KDEL endoplasmic reticulum protein retention receptor family. Retention of resident soluble proteins inThe lumen ofThe endoplasmic reticulum (ER) is achieved in both yeast and animal cells byTheir continual retrieval fromThe cis-Golgi, or a pre-Golgi compartment. Sorting ofThese proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae.This process is mediated by a receptor that recognizes, and bindsThe tetrapeptide-containing protein, and returns it toThe ER. In yeast,The sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs ofThe ERD2 gene, constitutingThe KDEL receptor gene family, have been described. KDELR3 wasThe third member ofThe family to be identified. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Synonyms ERD2L3
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 92%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Vibrio cholerae infection

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.