LMAN2 Rabbit Polyclonal Antibody

SKU TA341862

Rabbit Polyclonal Anti-LMAN2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LMAN2 antibody: synthetic peptide directed towards the N terminal of human LMAN2. Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: lectin, mannose binding 2
• Database Link:
  NP_006807
  Q12907
• Background: This gene encodes a type I transmembrane lectin that shuttles betweenThe endoplasmic reticulum,The Golgi apparatus andThe plasma membrane.The encoded protein binds high mannose type glycoproteins and may facilitateTheir sorting, trafficking and quality control. [provided by RefSeq, Oct 2008]
• Synonyms: C5orf8; GP36B; VIP36
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Transmembrane