CORIN Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-CORIN antibody: synthetic peptide directed towards the C terminal of human CORIN. Synthetic peptide located within the following region: HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 74 kDa |
| Gene Name | corin, serine peptidase |
| Database Link | |
| Background | This gene encodes a member ofThe type II transmembrane serine protease class ofThe trypsin superfamily. Members ofThis family are composed of multiple structurally distinct domains.The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure.This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found forThis gene. provided by RefSeq, Jun 2013 |
| Synonyms | ATC2; CRN; Lrp4; PEE5; TMPRSS10 |
| Note | Immunogen Sequence Homology: Human: 100%; Rat: 92%; Pig: 86%; Horse: 86%; Rabbit: 86%; Mouse: 79%; Bovine: 79%; Guinea pig: 79% |
| Reference Data | |
| Protein Categories | Enzyme: Peptidases, Intracellular Proteins, Membrane Proteins |
| Protein Families | Druggable Genome, Protease, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
