CORIN Rabbit Polyclonal Antibody

SKU TA341848

Rabbit Polyclonal Anti-CORIN Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CORIN antibody: synthetic peptide directed towards the C terminal of human CORIN. Synthetic peptide located within the following region: HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 74 kDa
• Gene Name: corin, serine peptidase
• Database Link:
  NP_006578
  Q9Y5Q5
• Background: This gene encodes a member ofThe type II transmembrane serine protease class ofThe trypsin superfamily. Members ofThis family are composed of multiple structurally distinct domains.The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure.This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jun 2013]
• Synonyms: ATC2; CRN; Lrp4; PEE5; TMPRSS10
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Pig: 86%; Horse: 86%; Rabbit: 86%; Mouse: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane