Ahrr Rabbit Polyclonal Antibody

SKU TA341832

Rabbit Polyclonal Anti-Ahrr Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ahrr antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CLRGGPDLLDPKGTSGDREEEDQKHILRRSPGAWGQREMHKYSYGLETPV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 78 kDa
• Gene Name: aryl-hydrocarbon receptor repressor
• Database Link:
  NP_033774
  Q3U1U7
• Background: Ahrr mediates dioxin toxicity and is involved in regulation of cell growth and differentiation. Ahrr repressesThe transcription activity of AHR by competing withThis transcription factor for heterodimer formation withThe ARNT and subsequently binding toThe xenobiotic response element (XRE) sequence present inThe promoter regulatory region of variety of genes. Ahrr represses CYP1A1 by bindingThe XRE sequence and recruiting ANKRA2, HDAC4 and/or HDAC5. Autoregulates its expression by associating with its own XRE site.
• Synonyms: AHH; AHHR; bHLHe77; KIAA1234; MGC167813; MGC176630
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%

Reference Data