DDX51 Rabbit Polyclonal Antibody

SKU TA341633

Rabbit Polyclonal Anti-DDX51 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDX51 antibody: synthetic peptide directed towards the middle region of human DDX51. Synthetic peptide located within the following region: FNIYTDATPLRVSLVTGQKSLAKEQESLVQKTADGYRCLADIVVATPGRL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: DEAD-box helicase 51
• Database Link:
  NP_778236
  Q8N8A6
• Background: ATP-binding RNA helicase involved inThe biogenesis of 60S ribosomal subunits.
• Synonyms: DKFZp686N2081; MGC42193
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Rabbit: 85%; Horse: 79%

Reference Data