TDRD9 Rabbit Polyclonal Antibody

SKU
TA341630
Rabbit Polyclonal Anti-TDRD9 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TDRD9 antibody: synthetic peptide directed towards the middle region of human TDRD9. Synthetic peptide located within the following region: AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 103 kDa
Gene Name tudor domain containing 9
Database Link
Background Probable ATP-binding RNA helicase which plays a central role during spermatogenesis by repressing transposable elements and preventingTheir mobilization, which is essential forThe germline integrity. Acts viaThe piRNA metabolic process, which mediatesThe repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governThe methylation and subsequent repression of transposons. Its association with PIWIL4 andThe piP-bodies suggests a participation inThe secondary piRNAs metabolic process.
Synonyms C14orf75; HIG-1; NET54
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 92%; Mouse: 92%; Dog: 85%; Pig: 85%; Horse: 85%; Guinea pig: 85%; Bovine: 77%
Reference Data
Write Your Own Review
You're reviewing:TDRD9 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.