SUPV3L1 Rabbit Polyclonal Antibody

SKU
TA341560
Rabbit Polyclonal Anti-SUPV3L1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SUPV3L1 antibody: synthetic peptide directed towards the N terminal of human SUPV3L1. Synthetic peptide located within the following region: QGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFH
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 88 kDa
Gene Name Suv3 like RNA helicase
Database Link
Background SUPV3L1 is an ATPase and DNA/RNA helicase able to unwind DNA/DNA, DNA/RNA and RNA/RNA duplexes inThe 5'-3' direction. SUPV3L1 may protect cells from apoptosis.
Synonyms SUV3
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 86%
Reference Data
Write Your Own Review
You're reviewing:SUPV3L1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.