SUPV3L1 Rabbit Polyclonal Antibody

SKU TA341560

Rabbit Polyclonal Anti-SUPV3L1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SUPV3L1 antibody: synthetic peptide directed towards the N terminal of human SUPV3L1. Synthetic peptide located within the following region: QGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 88 kDa
• Gene Name: Suv3 like RNA helicase
• Database Link:
  NP_003162
  Q8IYB8
• Background: SUPV3L1 is an ATPase and DNA/RNA helicase able to unwind DNA/DNA, DNA/RNA and RNA/RNA duplexes inThe 5'-3' direction. SUPV3L1 may protect cells from apoptosis.
• Synonyms: SUV3
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 86%

Reference Data