ZNF233 Rabbit Polyclonal Antibody

CAT#: TA341529

Reviews ()
Write a review

Rabbit Polyclonal Anti-ZNF233 Antibody


Product Datasheet for 'TA341529'


Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF233 antibody: synthetic peptide directed towards the middle region of human ZNF233. Synthetic peptide located within the following region: ERACKCDVYDKGFSQTSQLQAHQRGHSRDKTYKWEVSDRIFNRNSGLHQR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml
Predicted Protein Size 77 kDa
Gene Name zinc finger protein 233
Background May be involved in transcriptional regulation.
Synonyms FLJ38032
Note Immunogen Sequence Homology: Human: 100%; Rat: 79%
Reference Data
Other products for "ZNF233"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies