L3MBTL4 Rabbit Polyclonal Antibody

SKU TA341512

Rabbit Polyclonal Anti-L3MBTL4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-L3MBTL4 antibody: synthetic peptide directed towards the N terminal of human L3MBTL4. Synthetic peptide located within the following region: STTPLSHVPSAAAQGAWSWEWYLKEQKAVAAPVELFSKDQSFPEHENGFQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 71 kDa
• Gene Name: l(3)mbt-like 4 (Drosophila)
• Database Link:
  NP_775735
  Q8NA19
• Background: Putative Polycomb group (PcG) protein. PcG proteins maintainThe transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility.
• Synonyms: HsT1031
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%

Reference Data

• Protein Families: Transcription Factors