KLF14 Rabbit Polyclonal Antibody

CAT#: TA341450

Rabbit Polyclonal Anti-KLF14 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of Kruppel-like factor 14 (KLF14)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human Kruppel-like factor 14 (KLF14), 20 µg
    • 20 ug

USD 867.00

Other products for "KLF14"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KLF14 antibody: synthetic peptide directed towards the N terminal of human KLF14. Synthetic peptide located within the following region: SAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 33 kDa
Gene Name Kruppel-like factor 14
Background This intronless gene encodes a member ofThe Kruppel-like family of transcription factors.The encoded protein functions as a transcriptional co-repressor, and is induced by transforming growth factor-beta (TGF-beta) to repress TGF-beta receptor II gene expression.This gene exhibits imprinted expression fromThe maternal allele in embryonic and extra-embryonic tissues. [provided by RefSeq, Jul 2013]
Synonyms BTEB5
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rabbit: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.