KLF14 Rabbit Polyclonal Antibody

SKU TA341450

Rabbit Polyclonal Anti-KLF14 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLF14 antibody: synthetic peptide directed towards the N terminal of human KLF14. Synthetic peptide located within the following region: SAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 33 kDa
• Gene Name: Kruppel-like factor 14
• Database Link:
  NP_619638
  Q8TD94
• Background: This intronless gene encodes a member ofThe Kruppel-like family of transcription factors.The encoded protein functions as a transcriptional co-repressor, and is induced by transforming growth factor-beta (TGF-beta) to repress TGF-beta receptor II gene expression.This gene exhibits imprinted expression fromThe maternal allele in embryonic and extra-embryonic tissues. [provided by RefSeq, Jul 2013]
• Synonyms: BTEB5
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rabbit: 93%

Reference Data