HSFY1 Rabbit Polyclonal Antibody

SKU TA341428

Rabbit Polyclonal Anti-HSFY1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HSFY1 antibody: synthetic peptide directed towards the N terminal of human HSFY1. Synthetic peptide located within the following region: SWDENGTCIVINEELFKKEILETKAPYRIFQTDAIKSFVRQLNLYGFSKI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: heat shock transcription factor, Y-linked 1
• Database Link:
  NP_149099
  Q96LI6
• Background: This gene encodes a member ofThe heat shock factor (HSF) family of transcriptional activators for heat shock proteins.This gene is a candidate gene for azoospermia, since it localizes to a region of chromosome Y that is sometimes deleted in infertile males.The genome has two identical copies ofThis gene within a palindromic region;This record representsThe more centromeric copy. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
• Synonyms: HSF2L; HSFY
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 79%; Rat: 79%; Mouse: 79%; Bovine: 79%

Reference Data

• Protein Families: Transcription Factors